Lectin PLTL

Photorhabdus laumondii lectin with strong preference to α1,2-fucosylated ABO/Lewis glycans (BLeb, Leb, LeY, BGB)

Prices

Product number Product Form Package size In stock Lot number Price
GL-009 PLTL lectin lyophilized 1 mg 6 26154 200 EUR
5 mg - - 900 EUR
5x 1 mg 1 26154 900 EUR
10 mg - - 1700 EUR
bulk orders
Discounts may be applied for bulk orders. Biotinylated or fluorescently labeled (DyLight) variants can be provided upon request. Contact us at contact@4glyco.cz for prices and availability of those products.

Request quote

This product is for R&D use only, not for drug or diagnostic use. Not for use in humans or animals.

Basic information:

Name: PLTL
Organism: Photorhabdus laumondii
Expression host: Escherichia coli
Tags: no
Molar mass (monomer): 14811.7 Da
Extinction coefficient: 16055 M-1 cm-1
Oligomeric state: hexamer
PDB code: 9IB9 (with BLeb)​

Protein sequence:
SIVFASIDPRSNPLQTSSQNYVDIPGLKLDVSKYSNSPCLTALITLNIPTPYASGNNFPGGNFAIVTDQGEQLAYGGFTYSSKIPENSGRMPFTLVARYSLASNVSTIKAQWSNIRGSTVHIDSYASISAVIQCNQLV

3D structure of lectin PLTL from Photorhabdus laumondii in complex with BLeb pentasaccharide. PLTL lectin is in the hexameric form.

Carbohydrate specificity:

PLTL lectin prefers branched ABO/Lewis glycans with α1,2-linked fucose (mainly BLeb, ALeY, BLeY, and blood group B type 2). BLeb pentasaccharide is recognized with a higher affinity than Leb and LeY tetrasaccharides, and with much higher affinity than Lea trisaccharide. PLTL does not recognize LeX. Blood group B oligosaccharides are preferred over blood group A and H glycans. l-fucose is a weak binder. Crystallographic data suggest that PLTL could recognize glycans with 2O-methylated, α1,2-linked fucose [1].

Ion dependency: no
Glycan array data: download here

Stability:

Stable in a range of neutral and slightly acidic buffers. Avoid extreme pH (below 4 or above 10). After reconstitution in neutral pH buffers, the protein should be stable for weeks in the fridge. Adding sodium azide (0.02%) is recommended to avoid microbial growth.

Tm = 88 °C (nanoDSF, 0.1 M bicine, pH 8.0)

Applications and biological effects:

PLTL can be used, for example, in lectin microarrays, lectin blotting, fluorescence microscopy, flow cytometry, and lectin histochemistry experiments to detect the fucosylation of proteins, cells, and tissues. Also, it can be used to isolate specifically fucosylated glycans using, e.g., lectin affinity chromatography.

References:

  1. Melicher et al. FEBS J, 2025, doi: 10.1111/febs.70293

You are running an old browser version. We recommend updating your browser to its latest version.

More info