BP39L
Burkholderia pseudomallei lectin with a preference for branched, mannosylated oligosaccharides
Prices
Product number | Product | Form | Package size | In stock | Lot number | Price |
---|---|---|---|---|---|---|
GL-004 | BP39L lectin | lyophilized | 1 mg | - | - | - |
5 mg | - | - | - | |||
5x 1 mg | - | - | - | |||
10 mg | - | - | - | |||
bulk orders | ||||||
Discounts may be applied for bulk orders. Biotinylated or fluorescently labeled (DyLight) variants can be provided upon request. Contact us at contact@4glyco.cz for prices and availability of those products. |
Product Specification Sheet | .pdf 196 kB |
---|
This product is for R&D use only. Not for human or animal use.
Basic information:
Name: | BP39L |
Organism: | Burkholderia pseudomallei |
Expression host: | Escherichia coli |
Tags: | His6-TEV (N-terminus) |
Molar mass (monomer): | 37831.1 Da |
Extinction coefficient: | 78490 M-1 cm-1 |
Oligomeric state: | monomer |
PDB code: | 6GXR |
Protein sequence:
MHHHHHHENLYFQSAKLAASNQFGIPNQTDVFAVDGNGSLRVSWVVSAGAWNGPAQIGPAGLFPSRAAVASSNQFGIPNQTDVFAVGRDGALNVAWVVSADRWNGPTPISAAGLFPAGAAIAASNQFGIPNQTDVFAVSDSGALNVAWVVSAERWNGPIPISAAGHFPAGAPLATSNQFGIPNQTDVFVVDNKGALNVAWVVGAGSWNGPIPISPPGLFPPGAAVAASNQFGIPNQTDVFVVDNQGALNVAWVVGADRWNGPVPISPAGLFPPGAAVAASNQFGIPNQTDVFAVGRDGALRVAWVVSAGNWNGPVSISPTNLFPSGAAVAASNQFGIPNQTDVFAADSDGVLHVAWVVSAGNWNGPISIA

Carbohydrate specificity:
BP39L lectin has a preference for branched, mannosylated oligosaccharides with Man5 pentasaccharide (Manα1-6(Manα1-3)Manα1-6(Manα1-3)Manβ) being the best known ligand. The Manα1-6Man motif is preferred over its α1-2 and α1-3 isomers. The affinity for the monosaccharide itself (d-mannose) is weak (lower than 1 mM). Additionally, BP39L recognizes the Lewis b epitope [1].
Ion dependency: | no |
Glycan array data: | download |
Stability:
Most stable in slightly acidic and neutral buffers. BP39L tends to aggregate in alkaline pH. Avoid buffers with pH below 4 and above 9. Adding sodium azide (0.02%) is recommended to avoid microbial growth.
Tm = 74 °C (DSC, 20 mM Tris, 150 mM NaCl, pH 7.5)
Applications and biological effects:
BP39L lectin can be used to detect oligo-mannosylated structures on proteins, cells, and tissues in lectin blotting, fluorescence microscopy, flow cytometry, or lectin histochemistry experiments. Also, it can be used to isolate oligo-mannosylated species using, for example, lectin affinity chromatography.
References:
- Sýkorová et al, Int J Biol Macromol, 2020, doi: 10.1016/j.ijbiomac.2019.10.200