Lectin BP39L

Burkholderia pseudomallei lectin with a preference for branched, mannosylated oligosaccharides

Prices

Product number Product Form Package size In stock Lot number Price
GL-004 BP39L lectin lyophilized 1 mg 15 25553 200 EUR
5 mg 4 25553 900 EUR
5x 1 mg 1 25553 900 EUR
10 mg 1 25553 1700 EUR
bulk orders
Discounts may be applied for bulk orders. Biotinylated or fluorescently labeled (DyLight) variants can be provided upon request. Contact us at contact@4glyco.cz for prices and availability of those products.

Request quote

This product is for R&D use only. Not for human or animal use.

Basic information:

Name: BP39L
Organism: Burkholderia pseudomallei
Expression host: Escherichia coli
Tags: His6-TEV (N-terminus)
Molar mass (monomer): 37831.1 Da
Extinction coefficient: 78490 M-1 cm-1
Oligomeric state: monomer
PDB code: 6GXR

Protein sequence:
MHHHHHHENLYFQSAKLAASNQFGIPNQTDVFAVDGNGSLRVSWVVSAGAWNGPAQIGPAGLFPSRAAVASSNQFGIPNQTDVFAVGRDGALNVAWVVSADRWNGPTPISAAGLFPAGAAIAASNQFGIPNQTDVFAVSDSGALNVAWVVSAERWNGPIPISAAGHFPAGAPLATSNQFGIPNQTDVFVVDNKGALNVAWVVGAGSWNGPIPISPPGLFPPGAAVAASNQFGIPNQTDVFVVDNQGALNVAWVVGADRWNGPVPISPAGLFPPGAAVAASNQFGIPNQTDVFAVGRDGALRVAWVVSAGNWNGPVSISPTNLFPSGAAVAASNQFGIPNQTDVFAADSDGVLHVAWVVSAGNWNGPISIA

3D structure of lectin BP39L from Burkholderia pseudomallei (apo-form).

Carbohydrate specificity:

BP39L lectin has a preference for branched, mannosylated oligosaccharides with Man5 pentasaccharide (Manα1-6(Manα1-3)Manα1-6(Manα1-3)Manβ) being the best known ligand. The Manα1-6Man motif is preferred over its α1-2 and α1-3 isomers. The affinity for the monosaccharide itself (d-mannose) is weak (lower than 1 mM). Additionally, BP39L recognizes the Lewis b epitope [1].

Ion dependency: no
Glycan array data: download

Stability:

Most stable in slightly acidic and neutral buffers. BP39L tends to aggregate in alkaline pH. Avoid buffers with pH below 4 and above 9. Adding sodium azide (0.02%) is recommended to avoid microbial growth.

Tm = 74 °C (DSC, 20 mM Tris, 150 mM NaCl, pH 7.5)

Applications and biological effects:

BP39L lectin can be used to detect oligo-mannosylated structures on proteins, cells, and tissues in lectin blotting, fluorescence microscopy, flow cytometry, or lectin histochemistry experiments. Also, it can be used to isolate oligo-mannosylated species using, for example, lectin affinity chromatography.

References:

  1. Sýkorová et al, Int J Biol Macromol, 2020, doi: 10.1016/j.ijbiomac.2019.10.200

You are running an old browser version. We recommend updating your browser to its latest version.

More info