Lectin PA-IIL (LecB)
Highly thermostable, Ca2+-dependent lectin from Pseudomonas aeruginosa with a strong preference to fucosylated glycans
Prices
| Product number | Product | Form | Package size | In stock | Lot number | Price |
|---|---|---|---|---|---|---|
| GL-007 | PA-IIL lectin | lyophilized | 1 mg | 9 | 15750 | 160 EUR |
| 5 mg | 7 | 15750 | 720 EUR | |||
| 5x 1 mg | 2 | 15750 | 720 EUR | |||
| 10 mg | 4 | 15750 | 1360 EUR | |||
| bulk orders | ||||||
| Discounts may be applied for bulk orders. Biotinylated or fluorescently labeled (DyLight) variants can be provided upon request. Contact us at contact@4glyco.cz for prices and availability of those products. | ||||||
| Certificate of Analysis (Lot Number 15750) | .pdf 255 kB |
|---|
This product is for R&D use only. Not for human or animal use.
Basic information:
| Name: | PA-IIL (LecB, PA-II) |
| Organism: | Pseudomonas aeruginosa |
| Expression host: | Escherichia coli |
| Tags: | no |
| Molar mass (monomer): | 11731.8 Da |
| Extinction coefficient: | 6990 M-1 cm-1 |
| Oligomeric state: | tetramer |
| PDB code: | 1UZV (with Fuc) |
Protein sequence:
ATQGVFTLPANTRFGVTAFANSSGTQTVNVLVNNETAATFSGQSTNNAVIGTQVLNSGSSGKVQVQVSVNGRPSDLVSAQVILTNELNFALVGSEDGTDNDYNDAVVVINWPLG
Carbohydrate specificity:
PA-IIL (LecB, formerly PA-II) lectin strongly binds l-fucose, its derivatives, and many fucosylated oligosaccharides, including Lewis and blood group ABO antigens. It has the highest preference for Lewis a, sialyl-Lewis a, and blood group H (type 2) epitopes; other Lewis/ABO oligosaccharides are less efficient ligands. PA-IIL does not recognize blood group A and B epitopes (type 1). Besides l-fucose, PA-IIL binds d-mannose and mannosylated glycans with weak affinity [1-2].
| Ion dependency: | Ca2+-dependent |
| Glycan array data: | CFG web pages |
Stability:
Highly thermostable lectin. Stable in a variety of buffers with pH 4.0-10.0. Since the presence of calcium ions in the binding site is required for lectin activity, adding calcium ions (0.1-0.5 mM CaCl2) to the working buffer is recommended. Avoid EDTA and other chelating agents as they lead to removing Ca2+ ions from the binding site and losing lectin activity. After reconstitution in neutral pH buffers, the protein should be stable in the fridge for weeks. Adding sodium azide (0.02%) is recommended to avoid microbial growth.
Tm = 94 °C (DSC, 20 mM Tris, 150 mM NaCl, 0.1 mM CaCl2, pH 7.5)
Applications and biological effects:
PA-IIL can be used in various applications, including lectin blotting, fluorescence microscopy, flow cytometry, and lectin histochemistry. It is also used in commercial lectin microarrays to study glycosylations of proteins and cells.
PA-IIL inhibits ciliary beat in human airways [3,4]. It induces BCR- and CD19-dependent activation of B cells [5], impairs keratinocyte fitness by abrogating growth factor signaling [6], causes integrin internalization, and inhibits epithelial wound healing [7]. Also, PA-IIL lectin stimulates human peripheral lymphocytes and murine splenocytes [8] and induces differentiation of the acute myeloid leukemia cell line THP-1 [9].
References:
- Mitchell et al, Proteins, 2005, doi: 10.1002/prot.20330
- Topin et al, PLoS One, 2013, doi: 10.1371/journal.pone.0071149
- Adam et al, Am J Respir Crit Care Med, 1997, doi: 10.1164/ajrccm.155.6.9196121
- Mewe et al, J Laryngol Otol, 2005, doi: 10.1258/0022215054516313
- Wilhelm et al, Sci Signal, 2019, doi: 10.1126/scisignal.aao7194
- Landi et al, Life Sci Alliance, 2019, doi: 10.26508/lsa.201900422
- Thuenauer et al, mBio, 2020, doi: 10.1128/mBio.03260-19
- Avichezer et al, FEBS Lett, 1987, doi: 10.1016/0014-5793(87)80757-3
- Kühn et al, Cell Death Discov, 2015, doi: 10.1038/cddiscovery.2015.31