RSL
Ralstonia solanacearum lectin with a broad specificity towards fucosylated glycans (α1-2, α1-3, α1-4, α1-6)
Prices
Product number | Product | Form | Package size | In stock | Lot number | Price |
---|---|---|---|---|---|---|
GL-010 | RSL lectin | lyophilized | 1 mg | 10 | 13057 | 160 EUR |
5 mg | 4 | 13057 | 720 EUR | |||
5x 1 mg | 2 | 13057 | 720 EUR | |||
10 mg | 1 | 13057 | 1360 EUR | |||
bulk orders | ||||||
Discounts may be applied for bulk orders. Biotinylated or fluorescently labeled (DyLight) variants can be provided upon request. Contact us at contact@4glyco.cz for prices and availability of those products. |
Product Specification Sheet | .pdf 189 kB |
---|---|
Certificate Of Analysis (Lot Number 13057) | .pdf 255 kB |
This product is for R&D use only. Not for human or animal use.
Basic information:
Name: | RSL |
Organism: | Ralstonia solanacearum |
Expression host: | Escherichia coli |
Tags: | no |
Molar mass (monomer): | 9726.6 Da |
Extinction coefficient: | 44460 M-1 cm-1 |
Oligomeric state: | trimer |
PDB code: | 2BT9 (with MeFuc) |
Protein sequence:
SSVQTAATSWGTVPSIRVYTANNGKITERCWDGKGWYTGAFNEPGDNVSVTSWLVGSAIHIRVYASTGTTTTEWCWDGNGWTKGAYTATN

Carbohydrate specificity:
RSL binds l-fucose, methyl-fucoside, and a wide range of fucosylated oligosaccharides with terminal fucose bound through α1-2, α1-3, α1-4, and α1-6 linkages. β-fucosides are also recognized, albeit with lower affinities. In general, shorter and non-branched glycans are preferred over larger structures. RSL binds blood group trisaccharides (A, B, H type II), and Lewis epitopes. In addition, RSL binds xyloglucans (fucosylated plant polysaccharides) [1-2].
Ion dependency: | no |
Glycan array data: | CFG web pages |
Stability:
Stable in a range of neutral and slightly acidic buffers. For example, Tris, Hepes, phosphate and acetate are suitable buffers for RSL. Avoid extreme pH (below 4 or above 10). After reconstitution in neutral pH buffers, the protein should be stable in the fridge for weeks. Adding sodium azide (0.02%) is recommended to avoid microbial growth.
Tm = 83 °C (nanoDSF, PBS, pH 7.5)
Applications and biological effects:
Lectin RSL can detect fucosylation of proteins, cells, and tissues in lectin blotting, fluorescence microscopy, flow cytometry, or lectin histochemistry experiments. Also, it can be used to isolate fucosylated glycans or glycoproteins. RSL is found in commercial lectin microarrays.
The binding of RSL is known to induce the invagination of artificial lipid membranes containing fucosylated glycolipids and rapid lectin internalization upon binding to endothelial cells (H1299 cell line) [3].
References:
- Kostlánová et al, J Biol Chem, 2005, doi: 10.1074/jbc.M505184200
- Audfray et al, J Biol Chem, 2012, doi: 10.1074/jbc.M111.314831
- Arnaud et al, ACS Chem Biol, 2013, doi: 10.1021/cb400254b