RSL

Ralstonia solanacearum lectin with a broad specificity towards fucosylated glycans (α1-2, α1-3, α1-4, α1-6)

Prices

Product number Product Form Package size In stock Lot number Price
GL-010 RSL lectin lyophilized 1 mg 10 13057 160 EUR
5 mg 4 13057 720 EUR
5x 1 mg 2 13057 720 EUR
10 mg 1 13057 1360 EUR
bulk orders
Discounts may be applied for bulk orders. Biotinylated or fluorescently labeled (DyLight) variants can be provided upon request. Contact us at contact@4glyco.cz for prices and availability of those products.

Request quote

This product is for R&D use only. Not for human or animal use.

Basic information:

Name: RSL
Organism: Ralstonia solanacearum
Expression host: Escherichia coli
Tags: no
Molar mass (monomer): 9726.6 Da
Extinction coefficient: 44460 M-1 cm-1
Oligomeric state: trimer
PDB code: 2BT9 (with MeFuc)

Protein sequence:
SSVQTAATSWGTVPSIRVYTANNGKITERCWDGKGWYTGAFNEPGDNVSVTSWLVGSAIHIRVYASTGTTTTEWCWDGNGWTKGAYTATN

3D models of two protein structures, one colored in blue and the other in green, featuring complex folds and highlighted active sites with small molecule bindings.

Carbohydrate specificity:

RSL binds l-fucose, methyl-fucoside, and a wide range of fucosylated oligosaccharides with terminal fucose bound through α1-2, α1-3, α1-4, and α1-6 linkages. β-fucosides are also recognized, albeit with lower affinities. In general, shorter and non-branched glycans are preferred over larger structures. RSL binds blood group trisaccharides (A, B, H type II), and Lewis epitopes. In addition, RSL binds xyloglucans (fucosylated plant polysaccharides) [1-2].

Ion dependency: no
Glycan array data: CFG web pages

Stability:

Stable in a range of neutral and slightly acidic buffers. For example, Tris, Hepes, phosphate and acetate are suitable buffers for RSL. Avoid extreme pH (below 4 or above 10). After reconstitution in neutral pH buffers, the protein should be stable in the fridge for weeks. Adding sodium azide (0.02%) is recommended to avoid microbial growth.

Tm = 83 °C (nanoDSF, PBS, pH 7.5)

Applications and biological effects:

Lectin RSL can detect fucosylation of proteins, cells, and tissues in lectin blotting, fluorescence microscopy, flow cytometry, or lectin histochemistry experiments. Also, it can be used to isolate fucosylated glycans or glycoproteins. RSL is found in commercial lectin microarrays.

The binding of RSL is known to induce the invagination of artificial lipid membranes containing fucosylated glycolipids and rapid lectin internalization upon binding to endothelial cells (H1299 cell line) [3].

References:

  1. Kostlánová et al, J Biol Chem, 2005, doi: 10.1074/jbc.M505184200
  2. Audfray et al, J Biol Chem, 2012, doi: 10.1074/jbc.M111.314831
  3. Arnaud et al, ACS Chem Biol, 2013, doi: 10.1021/cb400254b

You are running an old browser version. We recommend updating your browser to its latest version.

More info