Lectin AFL (FleA)

Aspergillus fumigatus lectin with a broad specificity towards fucosylated glycans (α1-2, α1-3, α1-4, α1-6)​

Prices

Product number Product Form Package size In stock Lot number Price
GL-001 AFL lectin lyophilized 1 mg 5 03062 200 EUR
5 mg 1 03062 900 EUR
5x 1 mg 1 03062 900 EUR
10 mg - - 1700 EUR
bulk orders
Discounts may be applied for bulk orders. Biotinylated or fluorescently labeled (DyLight) variants can be provided upon request. Contact us at contact@4glyco.cz for prices and availability of those products.

Request quote

This product is for R&D use only. Not for human or animal use.

Basic information:

Name: AFL (FleA)
Organism: Aspergillus fumigatus
Expression host: Escherichia coli
Tags: no
Molar mass (monomer): 34450.4 Da
Extinction coefficient: 87320 M-1 cm-1
Oligomeric state: dimer
PDB code: 4AGI (with MeSeFuc)

Protein sequence:
STPGAQQVLFRTGIAAVNSTNHLRVYFQDVYGSIRESLYEGSWANGTEKNVIGNAKLGSPVAATSKELKHIRVYTLTEGNTLQEFAYDSGTGWYNGGLGGAKFQVAPYSCIAAVFLAGTDALQLRIYAQKPDNTIQEYMWNGDGWKEGTNLGGALPGTGIGATSFRYTDYNGPSIRIWFQTDDLKLVQRAYDPHKGWYPDLVTIFDRAPPRTAIAATSFGAGNSSIYMRIYFVNSDNTIWQVCWDHGKGYHDKGTITPVIQGSEVAIISWGSFANNGPDLRLYFQNGTYISAVSEWVWNRAHGSQLGRSALPPA

3D structure of lectin AFL (FleA) from Aspergillus fumigatus in complex with the selenium derivative of methyl fucoside. AFL lectin is in the dimeric form.

Carbohydrate specificity:

AFL (FleA) binds l-fucose and many fucosylated oligosaccharides with terminal fucose bound through α1-2, α1-3, and α1-4 linkages. AFL also binds core α1-6-fucosylated glycans, provided that fucose is sterically accessible. β-linked Fuc is recognized as well. In general, shorter and non-branched glycans are preferred over larger structures. AFL binds Lewis (Lea, Leb, LeX, LeY) and blood group (A, B, and H) determinants. Lewis Y is a slightly preferred epitope [1-2].

Ion dependency: no
Glycan array data: CFG web pages

Stability:

Stable in a range of neutral and slightly acidic buffers. Avoid extreme pH (below 4 or above 10) [3]. After reconstitution in neutral pH buffers, the protein should be stable for weeks in the fridge. Adding sodium azide (0.02%) is recommended to avoid microbial growth.

Tm = 51 °C (nanoDSF, PBS, pH 7.5)

Applications and biological effects:

AFL and closely related lectin AOL from Aspergillus oryzae are used in lectin blotting, fluorescence microscopy, flow cytometry, and lectin histochemistry experiments to detect the fucosylation of proteins, cells, and tissues. Also, they can be used to isolate fucosylated glycans using, e.g., lectin affinity chromatography. Both lectins are found in commercial lectin microarrays.

In addition, AFL was shown to have a pro-inflammatory effect on BEAS-2B [1], HCEC [4], A549, and MH-S [5] cells; AOL is known to induce anaphylactoid edema and mast cell activation through its interaction with fucose of mast cell-bound non-specific IgE [6].

References:

  1. Houser et al, PLoS One, 2013, doi: 10.1371/journal.pone.0083077
  2. Houser et al, Acta Crystallogr D Biol Crystallogr, 2015, doi: 10.1107/S1399004714026595
  3. Houser et al, Eur Biophys J, 2021 doi: 10.1007/s00249-021-01497-6
  4. Ballal et al, Mol Cell Biochem, 2017, doi: 10.1007/s11010-017-3050-9
  5. Sakai et al, Med Mycol, 2019, doi: 10.1093/mmy/myx163
  6. Yamaki et al, Scand J Immunol, 2011, doi: 10.1111/j.1365-3083.2011.02598.x

You are running an old browser version. We recommend updating your browser to its latest version.

More info