Lectin AFL (FleA)
Aspergillus fumigatus lectin with a broad specificity towards fucosylated glycans (α1-2, α1-3, α1-4, α1-6)
Prices
| Product number | Product | Form | Package size | In stock | Lot number | Price |
|---|---|---|---|---|---|---|
| GL-001 | AFL lectin | lyophilized | 1 mg | 5 | 03062 | 200 EUR |
| 5 mg | 1 | 03062 | 900 EUR | |||
| 5x 1 mg | 1 | 03062 | 900 EUR | |||
| 10 mg | - | - | 1700 EUR | |||
| bulk orders | ||||||
| Discounts may be applied for bulk orders. Biotinylated or fluorescently labeled (DyLight) variants can be provided upon request. Contact us at contact@4glyco.cz for prices and availability of those products. | ||||||
| Product Specification Sheet | .pdf 178 kB |
|---|---|
| Certificate of Analysis (Lot Number 03062) | .pdf 247 kB |
This product is for R&D use only. Not for human or animal use.
Basic information:
| Name: | AFL (FleA) |
| Organism: | Aspergillus fumigatus |
| Expression host: | Escherichia coli |
| Tags: | no |
| Molar mass (monomer): | 34450.4 Da |
| Extinction coefficient: | 87320 M-1 cm-1 |
| Oligomeric state: | dimer |
| PDB code: | 4AGI (with MeSeFuc) |
Protein sequence:
STPGAQQVLFRTGIAAVNSTNHLRVYFQDVYGSIRESLYEGSWANGTEKNVIGNAKLGSPVAATSKELKHIRVYTLTEGNTLQEFAYDSGTGWYNGGLGGAKFQVAPYSCIAAVFLAGTDALQLRIYAQKPDNTIQEYMWNGDGWKEGTNLGGALPGTGIGATSFRYTDYNGPSIRIWFQTDDLKLVQRAYDPHKGWYPDLVTIFDRAPPRTAIAATSFGAGNSSIYMRIYFVNSDNTIWQVCWDHGKGYHDKGTITPVIQGSEVAIISWGSFANNGPDLRLYFQNGTYISAVSEWVWNRAHGSQLGRSALPPA
Carbohydrate specificity:
AFL (FleA) binds l-fucose and many fucosylated oligosaccharides with terminal fucose bound through α1-2, α1-3, and α1-4 linkages. AFL also binds core α1-6-fucosylated glycans, provided that fucose is sterically accessible. β-linked Fuc is recognized as well. In general, shorter and non-branched glycans are preferred over larger structures. AFL binds Lewis (Lea, Leb, LeX, LeY) and blood group (A, B, and H) determinants. Lewis Y is a slightly preferred epitope [1-2].
| Ion dependency: | no |
| Glycan array data: | CFG web pages |
Stability:
Stable in a range of neutral and slightly acidic buffers. Avoid extreme pH (below 4 or above 10) [3]. After reconstitution in neutral pH buffers, the protein should be stable for weeks in the fridge. Adding sodium azide (0.02%) is recommended to avoid microbial growth.
Tm = 51 °C (nanoDSF, PBS, pH 7.5)
Applications and biological effects:
AFL and closely related lectin AOL from Aspergillus oryzae are used in lectin blotting, fluorescence microscopy, flow cytometry, and lectin histochemistry experiments to detect the fucosylation of proteins, cells, and tissues. Also, they can be used to isolate fucosylated glycans using, e.g., lectin affinity chromatography. Both lectins are found in commercial lectin microarrays.
In addition, AFL was shown to have a pro-inflammatory effect on BEAS-2B [1], HCEC [4], A549, and MH-S [5] cells; AOL is known to induce anaphylactoid edema and mast cell activation through its interaction with fucose of mast cell-bound non-specific IgE [6].
References:
- Houser et al, PLoS One, 2013, doi: 10.1371/journal.pone.0083077
- Houser et al, Acta Crystallogr D Biol Crystallogr, 2015, doi: 10.1107/S1399004714026595
- Houser et al, Eur Biophys J, 2021 doi: 10.1007/s00249-021-01497-6
- Ballal et al, Mol Cell Biochem, 2017, doi: 10.1007/s11010-017-3050-9
- Sakai et al, Med Mycol, 2019, doi: 10.1093/mmy/myx163
- Yamaki et al, Scand J Immunol, 2011, doi: 10.1111/j.1365-3083.2011.02598.x